PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G189300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 290aa    MW: 30988.7 Da    PI: 6.7015
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G189300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.8e-151562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+l d + ++G g+W++ +++ g+ R +k+c++rw +yl
  Sevir.7G189300.1.p 15 KGLWSPEEDEKLRDFILRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
                        678*******************************************97 PP

2Myb_DNA-binding52.89e-1769113248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         g ++ eE+e    ++++lG++ W+ Iar+++ gRt++++k++w++yl
  Sevir.7G189300.1.p  69 GMFSREEEETVMSLHAKLGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113
                         56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5611062IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-201065IPR009057Homeodomain-like
SuperFamilySSF466892.2E-2813109IPR009057Homeodomain-like
SMARTSM007175.5E-111464IPR001005SANT/Myb domain
PfamPF002495.9E-131562IPR001005SANT/Myb domain
CDDcd001671.65E-101862No hitNo description
PROSITE profilePS5129425.44863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2566116IPR009057Homeodomain-like
SMARTSM007174.8E-1467115IPR001005SANT/Myb domain
PfamPF002493.5E-1569113IPR001005SANT/Myb domain
CDDcd001672.61E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGCKACQKPK VQYRKGLWSP EEDEKLRDFI LRYGHGCWSA LPAKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSREEEETVM SLHAKLGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGG  120
AQAKCAADPA TPAGSDVRAG SPNPSDNGRE RANHPASSDS SEPVESSSAD DSSCLTVTEP  180
ARAGAVRPHA PVLPKVMFAD WLDMDYGTSL AALGPDAGVF DVSGRSPGQG LSHQGSVQVD  240
GPCGAVDSLH GLGDGGICGW GFDAAVDQMD VQGGGFCDLL SMTEFLGIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25151187109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9732630.0EU973263.1 Zea mays clone 395742 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976342.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K41e-60LAF1_ARATH; Transcription factor LAF1
TrEMBLK3YDJ90.0K3YDJ9_SETIT; Uncharacterized protein
STRINGSi012304m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-58myb domain protein 18